Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Nav1.6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP32126925UL
Description
Nav1.6 Polyclonal antibody specifically detects Nav1.6 in Human samples. It is validated for ImmunofluorescenceSpecifications
Nav1.6 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
CerIII, hNa6/Scn8a voltage-gated sodium channel, MED, NaCh6, Nav1.6, PN4, sodium channel protein type 8 subunit alpha, Sodium channel protein type VIII subunit alpha, sodium channel, voltage gated, type VIII, alpha polypeptide, sodium channel, voltage gated, type VIII, alpha subunit, Voltage-gated sodium channel subunit alpha Nav1.6 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: EMNNLQISVIRIKKGVAWTKLKVHAFMQAHFKQREADEVKPLDELYEKKANCIANHTGADIHRNGDFQKNGNGTT | |
25 μg | |
Neurodegeneration, Neuroscience | |
6334 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction