Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NAV3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$367.50 - $609.50
Specifications
Antigen | NAV3 |
---|---|
Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
NAV3 Polyclonal antibody specifically detects NAV3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
NAV3 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Protein Phosphatase | |
PBS, pH 7.2, 40% glycerol | |
89795 | |
IgG | |
Affinity purified |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
KIAA0938pore membrane and/or filament interacting like protein 1, neuron navigator 3, POMFIl1, POMFIL1steerin 3, Pore membrane and/or filament-interacting-like protein 1, steerin-3, STEERIN3, Unc-53 homolog 3, unc53H3 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: SPTFRRLFGAKAGGKSASAPNTEGVKSSSVMPSPSTTLARQGSLESPSSGTGSMGSAGGLSGSSSPLFNKPSD | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title