NBEAL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23355325UL

Catalog No. NB397400

Description

NBEAL1 Polyclonal specifically detects NBEAL1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NBEAL1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q6ZS30
• Gene Symbols: NBEAL1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QKDPDYLKLWLDTFVSSYEQFLDVDFEKLPTRVDDMPPGISLLPDNILQVLRIQLLQCVQKMADGLEE
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: A530083I02Rik, ALS2CR16, ALS2CR17FLJ22838, amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 16, amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 17, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 16 protein, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 17 protein, beach, FLJ26555, MGC164581, MGC168834, neurobeachin-like 1, neurobeachin-like protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 65065
• Target Species: Human
• Isotype: IgG

For Research Use Only