NBEAL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB397400	Novus Biologicals NBP23355325UL	25 μL
NBP233553	Novus Biologicals NBP233553	0.1 mL

Description

NBEAL1 Polyclonal specifically detects NBEAL1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NBEAL1
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: A530083I02Rik, ALS2CR16, ALS2CR17FLJ22838, amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 16, amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 17, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 16 protein, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 17 protein, beach, FLJ26555, MGC164581, MGC168834, neurobeachin-like 1, neurobeachin-like protein 1
• Gene Symbols: NBEAL1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q6ZS30
• Gene ID (Entrez): 65065
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QKDPDYLKLWLDTFVSSYEQFLDVDFEKLPTRVDDMPPGISLLPDNILQVLRIQLLQCVQKMADGLEE
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only