NCF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB436867	Novus Biologicals NBP23350225UL	25 μL
NBP233502	Novus Biologicals NBP233502	0.1 mL

Description

NCF1 Polyclonal specifically detects NCF1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NCF1
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 47 kDa neutrophil oxidase factor, FLJ79451, NADPH oxidase organizer 2, NCF-1, NCF1A, neutrophil cytosol factor 1,47 kDa autosomal chronic granulomatous disease protein, neutrophil cytosolic factor 1, neutrophil cytosolic factor 1 (47kD, chronic granulomatous disease, autosomal1), neutrophil cytosolic factor 1, (chronic granulomatous disease, autosomal 1), Neutrophil NADPH oxidase factor 1, Nox organizer 2, NOXO2NCF-47K, Nox-organizing protein 2, p47phox, SH3 and PX domain-containing protein 1A, SH3PXD1Ap47-phox
• Gene Symbols: NCF1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: P14598
• Gene ID (Entrez): 653361
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: YMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQRAAENHQ
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only