NDFIP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156990

Catalog No. NBP156990

Description

NDFIP2 Polyclonal specifically detects NDFIP2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NDFIP2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ25842, KIAA1165N4WBP5APutative MAPK-activating protein PM04/PM05/PM06/PM07, MAPK-activating protein PM04 PM05 PM06 PM07, N4wbp5a, Nedd4 family interacting protein 2, NEDD4 family-interacting protein 2, NEDD4 WW domain-binding protein 5A, NF-kappa-B-activating protein 413, Putative NF-kappa-B-activating protein 413
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NV92
• Gene Symbols: NDFIP2
• Immunogen: Synthetic peptides corresponding to NDFIP2 (Nedd4 family interacting protein 2) The peptide sequence was selected from the middle region of NDFIP2. Peptide sequence SFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFL.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 54602
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.