Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NDFIP2 Antibody, Novus Biologicals™
SDP

Catalog No. NB17419420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB17419420 20 μL
NBP174110 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB17419420 Supplier Novus Biologicals Supplier No. NBP17411020UL

Rabbit Polyclonal Antibody

NDFIP2 Polyclonal specifically detects NDFIP2 in Human, Rat samples. It is validated for Western Blot.

Specifications

Antigen NDFIP2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias FLJ25842, KIAA1165N4WBP5APutative MAPK-activating protein PM04/PM05/PM06/PM07, MAPK-activating protein PM04 PM05 PM06 PM07, N4wbp5a, Nedd4 family interacting protein 2, NEDD4 family-interacting protein 2, NEDD4 WW domain-binding protein 5A, NF-kappa-B-activating protein 413, Putative NF-kappa-B-activating protein 413
Gene Symbols NDFIP2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to the N terminal of Ndfip2. Immunizing peptide sequence YSSITVDGPTTSDADVYSEFYPVPPPYSVATSLPTYDEAEKAKAAALAAA.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54602
Target Species Human, Rat
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.