Learn More
Description
Specifications
Specifications
| Antigen | NDFIP2 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS and 2% Sucrose with 0.09% Sodium Azide |
| Gene Alias | FLJ25842, KIAA1165N4WBP5APutative MAPK-activating protein PM04/PM05/PM06/PM07, MAPK-activating protein PM04 PM05 PM06 PM07, N4wbp5a, Nedd4 family interacting protein 2, NEDD4 family-interacting protein 2, NEDD4 WW domain-binding protein 5A, NF-kappa-B-activating protein 413, Putative NF-kappa-B-activating protein 413 |
| Gene Symbols | NDFIP2 |
| Host Species | Rabbit |
| Immunogen | Synthetic peptides corresponding to the N terminal of Ndfip2. Immunizing peptide sequence YSSITVDGPTTSDADVYSEFYPVPPPYSVATSLPTYDEAEKAKAAALAAA. |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
