NDNL2 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP179687	100 μL

Catalog No. NBP179687 Supplier Novus Biologicals Supplier No. NBP179687

Description

Rabbit Polyclonal Antibody

NDNL2 Polyclonal specifically detects NDNL2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NDNL2
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: NP_619649
• Gene Alias: HCA4hepatocellular carcinoma-associated protein HCA4, Hepatocellular carcinoma-associated protein 4, MAGEG1MAGE-G1 antigen, MAGEL3, melanoma antigen, family G, 1, melanoma-associated antigen G1, necdin-like 2, necdin-like gene 2, Necdin-like protein 2, NSE3, NSMCE3
• Gene Symbols: NDNL2
• Host Species: Rabbit
• Immunogen: Synthetic peptide directed towards the middle region of human NDNL2The immunogen for this antibody is NDNL2. Peptide sequence IFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVL.
• Molecular Weight of Antigen: 34 kDa
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 56160
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only