Learn More
Description
Specifications
Specifications
| Antigen | NDUFA4L2 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2, NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2, NADH:ubiquinone oxidoreductase MLRQ subunit homolog, NADH-ubiquinone oxidoreductase MLRQ subunit homolog, NUOMSFLJ26118 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse NDUFA4L2 (NP_001092259.1). Peptide sequence LLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
