Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NDUFA9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	NDUFA9
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP1547620 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15476120UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP154761 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP154761	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

NDUFA9 Polyclonal specifically detects NDUFA9 in Human samples. It is validated for Western Blot.

Specifications

Antigen	NDUFA9
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Core ESC Like Genes, Stem Cell Markers
Gene Alias	CC6, CI39k, CI-39k, CI-39kD, complex I 39kDa subunit, Complex I-39kD, MGC111043, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 (39kD), NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa, NADH dehydrogenase (ubiquinone) Fe-S protein 2-like (NADH-coenzyme Q reductase), NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial, NADH-ubiquinone oxidoreductase 39 kDa subunit, NDUFS2L, SDR22E1, short chain dehydrogenase/reductase family 22E, member 1
Gene Symbols	NDUFA9
Isotype	IgG
Test Specificity	This product is specific to Subunit or Isoform: 9, mitochondrial.

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q16795
Gene ID (Entrez)	4704
Immunogen	Synthetic peptides corresponding to NDUFA9(NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa) The peptide sequence was selected from the N terminal of NDUFA9. Peptide sequence QLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPY.
Primary or Secondary	Primary
Molecular Weight of Antigen	42 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

NDUFA9 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents