NDUFB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25717025UL

Catalog No. NB394098

Description

NDUFB1 Polyclonal specifically detects NDUFB1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: NDUFB1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: CI-MNLLCI-SGDH, complex I MNLL subunit, Complex I-MNLL, MNLL, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1 (7kD, MNLL), NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1, NADH-ubiquinone oxidoreductase MNLL subunit
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4707
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: NDUFB1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only