Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NDUFB11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18395625UL
Description
NDUFB11 Polyclonal specifically detects NDUFB11 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
NDUFB11 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
CI-ESSS, complex I NP17.3 subunit, Complex I-ESSS, ESSS, FLJ20494, MGC111182, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial, NADH-ubiquinone oxidoreductase ESSS subunit, Neuronal protein 17.3, Np15, Np17.3, P17.3 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
NDUFB11 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:PDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE | |
25 μL | |
Stem Cell Markers | |
54539 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction