NDUFB11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB418642	Novus Biologicals NBP18395625UL	25 μL
NBP183956	Novus Biologicals NBP183956	0.1 mL

Description

NDUFB11 Polyclonal specifically detects NDUFB11 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: NDUFB11
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: CI-ESSS, complex I NP17.3 subunit, Complex I-ESSS, ESSS, FLJ20494, MGC111182, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial, NADH-ubiquinone oxidoreductase ESSS subunit, Neuronal protein 17.3, Np15, Np17.3, P17.3
• Gene Symbols: NDUFB11
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Stem Cell Markers
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 54539
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only