Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ndufs1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25650425UL
Description
Ndufs1 Polyclonal specifically detects Ndufs1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| Ndufs1 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| CI-75k, CI-75Kd, complex I 75kDa subunit, complex I, mitochondrial respiratory chain, 75-kD subunit, Complex I-75kD, EC 1.6.5.3, EC 1.6.99.3, MGC26839, mitochondrial NADH-ubiquinone oxidoreductase 75 kDa subunit, NADH dehydrogenase (ubiquinone) Fe-S protein 1 (75kD) (NADH-coenzyme Qreductase), NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Qreductase), NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial, PRO1304 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
| IgG |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| NDUFS1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:REDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAV | |
| 25 μL | |
| Vision | |
| 4719 | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction