Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ndufs1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | Ndufs1 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Ndufs1 Polyclonal specifically detects Ndufs1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| Ndufs1 | |
| Polyclonal | |
| Rabbit | |
| Vision | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 4719 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:REDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| CI-75k, CI-75Kd, complex I 75kDa subunit, complex I, mitochondrial respiratory chain, 75-kD subunit, Complex I-75kD, EC 1.6.5.3, EC 1.6.99.3, MGC26839, mitochondrial NADH-ubiquinone oxidoreductase 75 kDa subunit, NADH dehydrogenase (ubiquinone) Fe-S protein 1 (75kD) (NADH-coenzyme Qreductase), NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Qreductase), NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial, PRO1304 | |
| NDUFS1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title