NDUFV2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25883725UL

Catalog No. NB403105

Description

NDUFV2 Polyclonal specifically detects NDUFV2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: NDUFV2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: CI-24k, mitochondrial respitory chain, 24 kD subunit, NADH dehydrogenase (ubiquinone) flavoprotein 2 (24kD), NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa, NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial, NADH dehydrogenase ubiquinone flavoprotein 2, mitochondrial, NADH-ubiquinone oxidoreductase 24 kDa subunit, NADH-ubiquinone oxidoreductase flavoprotein 2, nuclear-encoded mitochondrial NADH-ubiquinone reductase 24Kd subunit
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: NDUFV2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:('MFFSAALRARAAGLTAHWGRHVRNLHKTAMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNY',)
• Quantity: 25 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 4729
• Target Species: Human
• Form: Purified

For Research Use Only