Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NECAB1 Antibody (CL0575), Novus Biologicals™

NECAB1 Antibody (CL0575), Novus Biologicals™
SDP

Catalog No. NB395340 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB395340 25 μL
NBP252945 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB395340 Supplier Novus Biologicals Supplier No. NBP25294525UL
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

NECAB1 Monoclonal antibody specifically detects NECAB1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen NECAB1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL0575
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias EF hand calcium binding protein 1, EFCBP1, EF-hand calcium binding protein 1, EF-hand calcium-binding protein 1, neuronal calcium binding protein, Neuronal calcium-binding protein 1, N-terminal EF-hand calcium binding protein 1, N-terminal EF-hand calcium-binding protein 1, STIP-1, synaptotagmin interacting protein 1
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPGKRSSRRVQRHNSFSPNSP
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 64168
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.