Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NECAB3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP156552
Description
NECAB3 Polyclonal specifically detects NECAB3 in Human samples. It is validated for Western Blot.Specifications
NECAB3 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
NECAB3 | |
Synthetic peptides corresponding to NECAB3 (N-terminal EF-hand calcium binding protein 3) The peptide sequence was selected from the middle region of NECAB3)(50ug). Peptide sequence ESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQV. | |
100 μL | |
Lipid and Metabolism | |
63941 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Amyloid beta A4 protein-binding family A member 2-binding protein, APBA2BPfamily A, member 2 binding protein, dJ63M2.4, dJ63M2.5, EFCBP3STIP3, EF-hand calcium binding protein 3, Neuronal calcium-binding protein 3, neuronal calcium-binding protein NECAB3, NIP1Nek2-interacting protein 1, N-terminal EF-hand calcium binding protein 3, N-terminal EF-hand calcium-binding protein 3, synaptotagmin interacting protein 2, synaptotagmin interacting protein STIP3, SYTIP2, XB51X11L-binding protein 51 | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Rat: 100%; Canine: 92%; Rabbit: 92%. | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction