NECAP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157626

Catalog No. NBP157626

Description

NECAP2 Polyclonal specifically detects NECAP2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NECAP2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: adaptin ear-binding coat-associated protein 2, adaptin-ear-binding coat-associated protein 2, FLJ10420, NECAP endocytosis associated 2, NECAP endocytosis-associated protein 2, NECAP-2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55707
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NVZ3
• Gene Symbols: NECAP2
• Immunogen: Synthetic peptides corresponding to NECAP2(NECAP endocytosis associated 2) The peptide sequence was selected from the N terminal of NECAP2. Peptide sequence WQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESV.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Xenopus: 92%; Chicken: 92%; Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG