Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NECAP2 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen NECAP2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP157626
SDP
View Documents
Novus Biologicals
NBP157626
100 μL
Each of 1 for $487.50
Only null left
Add to Cart
 
Description

Description

NECAP2 Polyclonal specifically detects NECAP2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

NECAP2
Polyclonal
Rabbit
Q9NVZ3
55707
Synthetic peptides corresponding to NECAP2(NECAP endocytosis associated 2) The peptide sequence was selected from the N terminal of NECAP2. Peptide sequence WQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESV.
Primary
Western Blot
Unconjugated
RUO
adaptin ear-binding coat-associated protein 2, adaptin-ear-binding coat-associated protein 2, FLJ10420, NECAP endocytosis associated 2, NECAP endocytosis-associated protein 2, NECAP-2
NECAP2
IgG
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.