Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NEK2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25742425UL
Description
NEK2 Polyclonal specifically detects NEK2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
NEK2 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
EC 2.7.11, EC 2.7.11.1, HSPK 21, NEK2AHsPK21, Never in mitosis A-related kinase 2, NIMA (never in mitosis gene a)-related kinase 2, NimA-like protein kinase 1, NimA-related protein kinase 2, NLK1serine/threonine-protein kinase Nek2 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
NEK2 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPE | |
25 μL | |
Cell Cycle and Replication, Core ESC Like Genes, Mitotic Regulators, Stem Cell Markers | |
4751 | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction