Neprilysin/CD10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24870125UL

Catalog No. NB396030

Description

Neprilysin/CD10 Polyclonal antibody specifically detects Neprilysin/CD10 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Neprilysin/CD10
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: Atriopeptidase, CALLAmembrane metallo-endopeptidase (neutral endopeptidase, enkephalinase), CD10 antigen, CD10), CD10membrane metallo-endopeptidase variant 1, Common acute lymphocytic leukemia antigen, DKFZp686O16152, EC 3.4.24, EC 3.4.24.11, Enkephalinase, EPN, membrane metallo-endopeptidase, membrane metallo-endopeptidase variant 2, MGC126681, MGC126707, NEPmembrane metallo-endopeptidase (neutral endopeptidase, enkephalinase, CALLA, neprilysin, Neutral endopeptidase, Neutral endopeptidase 24.11, SFE, Skin fibroblast elastase
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: STVNISITNEEDVVVYAPEYLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRN
• Quantity: 25 μL
• Research Discipline: B Cell Development and Differentiation Markers, Cancer, Cell Biology, Cytokine Research, Immunology, Stem Cell Markers
• Gene ID (Entrez): 4311
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified