Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Neprilysin/CD10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
Antigen | Neprilysin/CD10 |
---|---|
Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
Neprilysin/CD10 Polyclonal antibody specifically detects Neprilysin/CD10 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
Neprilysin/CD10 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
B Cell Development and Differentiation Markers, Cancer, Cell Biology, Cytokine Research, Immunology, Stem Cell Markers | |
PBS (pH 7.2), 40% Glycerol | |
4311 | |
IgG | |
Immunogen affinity purified |
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
Atriopeptidase, CALLAmembrane metallo-endopeptidase (neutral endopeptidase, enkephalinase), CD10 antigen, CD10), CD10membrane metallo-endopeptidase variant 1, Common acute lymphocytic leukemia antigen, DKFZp686O16152, EC 3.4.24, EC 3.4.24.11, Enkephalinase, EPN, membrane metallo-endopeptidase, membrane metallo-endopeptidase variant 2, MGC126681, MGC126707, NEPmembrane metallo-endopeptidase (neutral endopeptidase, enkephalinase, CALLA, neprilysin, Neutral endopeptidase, Neutral endopeptidase 24.11, SFE, Skin fibroblast elastase | |
This antibody was developed against a recombinant protein corresponding to amino acids: STVNISITNEEDVVVYAPEYLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRN | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title