Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NEPRO Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15991920UL
Description
NEPRO Polyclonal specifically detects NEPRO in Human samples. It is validated for Western Blot.Specifications
C3orf17 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
A8MVI8 | |
C3ORF17 | |
Synthetic peptides corresponding to C3ORF17 The peptide sequence was selected from the middle region of C3ORF17. Peptide sequence KLQSTLLREIQQFSQGTRKSATDTSAKWRLSHCTVHRTDLYPNSKQLLNS. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
chromosome 3 open reading frame 17, DKFZP434F2021, hypothetical protein LOC25871, NET17 | |
Rabbit | |
Affinity Purified | |
RUO | |
25871 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction