Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NEPRO Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | C3orf17 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15991920
![]() |
Novus Biologicals
NBP15991920UL |
20 μL |
Each for $206.00
|
|
|||||
NBP159919
![]() |
Novus Biologicals
NBP159919 |
100 μL |
Each for $487.50
|
|
|||||
Description
NEPRO Polyclonal specifically detects NEPRO in Human samples. It is validated for Western Blot.Specifications
C3orf17 | |
Polyclonal | |
Rabbit | |
Human | |
chromosome 3 open reading frame 17, DKFZP434F2021, hypothetical protein LOC25871, NET17 | |
C3ORF17 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
A8MVI8 | |
25871 | |
Synthetic peptides corresponding to C3ORF17 The peptide sequence was selected from the middle region of C3ORF17. Peptide sequence KLQSTLLREIQQFSQGTRKSATDTSAKWRLSHCTVHRTDLYPNSKQLLNS. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title