Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Nesprin 2 Antibody, Novus Biologicals™
SDP

Catalog No. NB396739 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396739 25 μL
NBP238620 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB396739 Supplier Novus Biologicals Supplier No. NBP23862025UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Nesprin 2 Polyclonal specifically detects Nesprin 2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen Nesprin 2
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q8WXH0
Gene Alias DKFZP434H2235, DKFZp686E01115, DKFZp686H1931, EDMD5, FLJ46790, KIAA1011FLJ11014, nesprin 2, nesprin-2, NUAFLJ43727, NUANCEFLJ45710, Nuclear envelope spectrin repeat protein 2, Nucleus and actin connecting element protein, polytrophin, Protein NUANCE, spectrin repeat containing, nuclear envelope 2, Synaptic nuclear envelope protein 2, synaptic nuclei expressed gene 2, SYNE-2, TROPH
Gene Symbols SYNE2
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: GTTPPIEADTLDSSDAQGGLEPRVEKTRPEPTEVLHACKTQVAELELWLQQANVAVEPETLNADMQQVLEQQLVGCQAMLTEIEHKVAFLLETCKDQGLGDNGATQHEAEALSLKLKTVKCNLEKVQMMLQEKHSEDQ
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Developmental Biology
Primary or Secondary Primary
Gene ID (Entrez) 23224
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.