Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NEURL2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP1706520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1706520 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP1706520 Supplier Novus Biologicals Supplier No. NBP17065120UL

Rabbit Polyclonal Antibody

NEURL2 Polyclonal specifically detects NEURL2 in Human samples. It is validated for Western Blot.

Specifications

Antigen NEURL2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias C20orf163, chromosome 20 open reading frame 163, dJ337O18.6, FLJ30259, MGC125934, MGC125935, neuralized homolog 2 (Drosophila), neuralized-like 2, neuralized-like 2 (Drosophila), neuralized-like protein 2, OZZ, Ozz-E3
Gene Symbols NEURL2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to NEURL2(neuralized homolog 2 (Drosophila)) The peptide sequence was selected form the middle region of NEURL2. Peptide sequence VEPYLRIEQFRIPRDRLVGRSRPGLYSHLLDQLYELNVLPPTARRSRLGV.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 140825
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.