Neurofibromin 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP325009

Catalog No. NB301443

Description

Neurofibromin 1 Polyclonal antibody specifically detects Neurofibromin 1 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: Neurofibromin 1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: DKFZp686J1293, FLJ21220, Neurofibromatosis-related protein NF-1, neurofibromin, neurofibromin 1, NFNS, VRNF, WSS
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Neurofibromin 1 using the following amino acid sequence: MARRDDLSFCQEMKFRNKMVEYLTDWVMGTSNQAADDDV
• Quantity: 100 μL
• Research Discipline: Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, Hypoxia, Neuroscience, Neurotransmission, Phospho Specific, Signal Transduction, Transcription Factors and Regulators, Tumor Suppressors
• Gene ID (Entrez): 4763
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified