Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Neuroglycan C/CSPG5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP258590
Description
Neuroglycan C/CSPG5 Polyclonal specifically detects Neuroglycan C/CSPG5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Neuroglycan C/CSPG5 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
CALEB, chondroitin sulfate proteoglycan 5, chondroitin sulfate proteoglycan 5 (neuroglycan C), MGC44034, Neuroglycan C, NGCAcidic leucine-rich EGF-like domain-containing brain protein | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
CSPG5 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SLSTIAEGSHPNVRKLCNTPRTSSPHARALAHYDNVICQDDPSAPHKIQEVLKSCLKEEESFNIQNSMSPKLEGGKGDQADLDVNCL | |
100 μL | |
Cellular Markers, Neuroscience | |
10675 | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only