Neuroligin 4X/NLGN4X Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159255

Catalog No. NBP159255

Description

Neuroligin 4X/NLGN4X Polyclonal specifically detects Neuroligin 4X/NLGN4X in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Neuroligin 4X/NLGN4X
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ASPGX2, HLNX, HNLX, KIAA1260AUTSX2, MGC22376, neuroligin 4, X-linked, NLGN, NLGN4neuroligin 4, X-linked
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57502
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8NFZ3
• Gene Symbols: NLGN4X
• Immunogen: Synthetic peptides corresponding to NLGN4X(neuroligin 4, X-linked) The peptide sequence was selected from the N terminal of NLGN4X. Peptide sequence SILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEEN.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 100%; Equine: 100%; Pig: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG