Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Neuroligin 4X/NLGN4X Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Neuroligin 4X/NLGN4X |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Neuroligin 4X/NLGN4X Polyclonal specifically detects Neuroligin 4X/NLGN4X in Human samples. It is validated for Western Blot.Specifications
Neuroligin 4X/NLGN4X | |
Polyclonal | |
Rabbit | |
Q8NFZ3 | |
57502 | |
Synthetic peptides corresponding to NLGN4X(neuroligin 4, X-linked) The peptide sequence was selected from the N terminal of NLGN4X. Peptide sequence SILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEEN. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ASPGX2, HLNX, HNLX, KIAA1260AUTSX2, MGC22376, neuroligin 4, X-linked, NLGN, NLGN4neuroligin 4, X-linked | |
NLGN4X | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title