NF-H Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP237984

Catalog No. NBP237984

Description

NF-H Polyclonal specifically detects NF-H in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NF-H
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P12036
• Gene Symbols: NEFH
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ECRIGFGPIPFSLPEGLPKIPSVSTHIKVKSEEKIKVVEKSEKETVIVEEQTEETQVTEEVTEE
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 200 kDa neurofilament protein, KIAA0845, Neurofilament Heavy (200kDa), neurofilament heavy polypeptide, Neurofilament triplet H protein, neurofilament, heavy polypeptide, neurofilament, heavy polypeptide 200kDa, NF200, NFH, NF-H
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4744
• Target Species: Human
• Isotype: IgG