Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NF-H Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | NF-H |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
NF-H Polyclonal specifically detects NF-H in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| NF-H | |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 200 kDa neurofilament protein, KIAA0845, Neurofilament Heavy (200kDa), neurofilament heavy polypeptide, Neurofilament triplet H protein, neurofilament, heavy polypeptide, neurofilament, heavy polypeptide 200kDa, NF200, NFH, NF-H | |
| NEFH | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| P12036 | |
| 4744 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: ECRIGFGPIPFSLPEGLPKIPSVSTHIKVKSEEKIKVVEKSEKETVIVEEQTEETQVTEEVTEE | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title