Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NF-L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25869925UL
Description
NF-L Polyclonal specifically detects NF-L in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
NF-L | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
68 kDa neurofilament protein, neurofilament protein, light chain, neurofilament subunit NF-L, Neurofilament triplet L protein, neurofilament, light polypeptide, neurofilament-light, NF68FLJ53642, NF-L, NFLlight polypeptide 68kDa | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
NEFL | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRF | |
25 μL | |
Autophagy, Cellular Markers, Cytoskeleton Markers, Neurodegeneration, Neurofilaments, Neuronal Cell Markers, Neuroscience | |
4747 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction