Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NF-M Antibody (CL2705), Novus Biologicals™

NF-M Antibody (CL2705), Novus Biologicals™
SDP

Catalog No. NB396385 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396385 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB396385 Supplier Novus Biologicals Supplier No. NBP24662525UL
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

NF-M Monoclonal antibody specifically detects NF-M in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen NF-M
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL2705
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000
Formulation PBS (pH 7.2), 40% Glycerol
Gene Accession No. P07197
Gene Alias NEF3neurofilament medium polypeptide, Neurofilament 3, neurofilament, medium polypeptide, neurofilament, medium polypeptide 150kDa, neurofilament-3 (150 kD medium), NF-M160 kDa neurofilament protein, NFMNeurofilament triplet M protein
Host Species Mouse
Immunogen Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence YIEKVHYLEQQNKEIEAEIQALRQKQASHAQLGDAYDQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHRLKERFEEEARLRDDTEAAIRALRKDIEEASLVKVELDKKVQSLQDEVAFLRSNH
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Autophagy, Cell Biology, Cellular Markers, Neurodegeneration, Neuronal Cell Markers, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 4741
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.