Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NF-M Antibody (CL2705), Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP24662525UL
Description
NF-M Monoclonal antibody specifically detects NF-M in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
NF-M | |
Monoclonal | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol | |
NEF3neurofilament medium polypeptide, Neurofilament 3, neurofilament, medium polypeptide, neurofilament, medium polypeptide 150kDa, neurofilament-3 (150 kD medium), NF-M160 kDa neurofilament protein, NFMNeurofilament triplet M protein | |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence YIEKVHYLEQQNKEIEAEIQALRQKQASHAQLGDAYDQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHRLKERFEEEARLRDDTEAAIRALRKDIEEASLVKVELDKKVQSLQDEVAFLRSNH | |
25 μL | |
Autophagy, Cell Biology, Cellular Markers, Neurodegeneration, Neuronal Cell Markers, Neuroscience | |
4741 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG2b |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
CL2705 | |
Western Blot 1 μg/mL, Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000 | |
P07197 | |
Mouse | |
Protein A purified | |
RUO | |
Primary | |
Human, Mouse, Rat | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction