Learn More
Description
Specifications
Specifications
| Antigen | NFAT5 |
| Applications | Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | EC 3.6.1, EC 3.6.3.14, KIAA0827glutamine rich protein H65, NF-AT5NFAT-like protein 1, NFATL1, NFATZ, nuclear factor of activated T-cells 5, tonicity-responsive, OREBP, osmotic response element-binding protein, T-cell transcription factor NFAT5, TonE-binding protein, TonEBP, TONEBPnuclear factor of activated T-cells 5, Tonicity-responsive enhancer-binding protein |
| Host Species | Rabbit |
| Immunogen | This antibody has been engineered to specifically recognize the recombinant protein NFAT5 using the following amino acid sequence: TTSSEQMQPPMFHSQSTIAVLQGSSVPQDQQSTNIFLSQSPMNNLQTNTVAQEAFFAAPNSISPLQSTSNSEQQAAFQQQAPISH |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
