NFATC4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257613

Catalog No. NBP257613

Description

NFATC4 Polyclonal specifically detects NFATC4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: NFATC4
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: NF-AT3, NFAT3nuclear factor of activated T-cells, cytoplasmic 4, NFATc4, NF-ATc4, nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4, T cell transcription factor NFAT3, T-cell transcription factor NFAT3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: NFATC4
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:('ETRGTTGCAQPPAVSFLPRPFPSDPYGGRGSSFSLGLPFSPPAPFRPPPLPASPPLEGPFPSQSDVHPLPAEGYNKVGPGYGPGE',)
• Quantity: 100 μL
• Research Discipline: Transcription Factors and Regulators, Wnt Signaling Pathway
• Gene ID (Entrez): 4776
• Target Species: Human
• Isotype: IgG

For Research Use Only