NGFI-B alpha/Nur77/NR4A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP26889625UL

Catalog No. NB392843

Description

NGFI-B alpha/Nur77/NR4A1 Polyclonal antibody specifically detects NGFI-B alpha/Nur77/NR4A1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: NGFI-B alpha/Nur77/NR4A1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: Early response protein NAK1, GFRP1ST-59, growth factor-inducible nuclear protein N10, HMRNP10, hormone receptor, MGC9485, N10, NAK1, NAK-1, NGFIB, Nuclear hormone receptor NUR/77, nuclear receptor subfamily 4 group A member 1, nuclear receptor subfamily 4, group A, member 1, NUR77, Orphan nuclear receptor HMR, Orphan nuclear receptor TR3, steroid receptor TR3, Testicular receptor 3, TR3, TR3 orphan receptor
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLS
• Quantity: 25 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 3164
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified