NGL-3/LRRC4B/LRCH4B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP231736

Catalog No. NBP231736

Description

NGL-3/LRRC4B/LRCH4B Polyclonal specifically detects NGL-3/LRRC4B/LRCH4B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: NGL-3/LRRC4B/LRCH4B
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9NT99
• Gene Symbols: LRRC4B
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GTEKEPPGPTTDGVWGGGRPGDAAGPASSSTTAPAPRSSRPTEKAFTVPITDVTENALKDLDD
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DKFZp761A179, HSM, Leucine Rich Repeat Containing 4B, Leucine-Rich Repeat-Containing Protein 4B, Leucine-Rich Repeats And Immunoglobulin-Like Domains 4, LRIG4, LRRC4B, Netrin-G3 Ligand, NGL-3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 94030
• Target Species: Human
• Isotype: IgG

For Research Use Only