Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NGL-3/LRRC4B/LRCH4B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | NGL-3/LRRC4B/LRCH4B |
---|---|
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
NGL-3/LRRC4B/LRCH4B Polyclonal specifically detects NGL-3/LRRC4B/LRCH4B in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
NGL-3/LRRC4B/LRCH4B | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
DKFZp761A179, HSM, Leucine Rich Repeat Containing 4B, Leucine-Rich Repeat-Containing Protein 4B, Leucine-Rich Repeats And Immunoglobulin-Like Domains 4, LRIG4, LRRC4B, Netrin-G3 Ligand, NGL-3 | |
LRRC4B | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Polyclonal | |
Rabbit | |
Human | |
Q9NT99 | |
94030 | |
This antibody was developed against a recombinant protein corresponding to amino acids: GTEKEPPGPTTDGVWGGGRPGDAAGPASSSTTAPAPRSSRPTEKAFTVPITDVTENALKDLDD | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title