Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NHA2/SLC9B2/NHEDC2 Antibody, Novus Biologicals™

NHA2/SLC9B2/NHEDC2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159579 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159579 100 μL
NBP15957920 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP159579 Supplier Novus Biologicals Supplier No. NBP159579
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

NHA2/SLC9B2/NHEDC2 Polyclonal specifically detects NHA2/SLC9B2/NHEDC2 in Human samples. It is validated for Western Blot.

Specifications

Antigen NHA2/SLC9B2/NHEDC2
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q86UD5
Gene Alias FLJ23984, Mitochondrial Na(+)/H(+) exchanger NHA2, mitochondrial sodium/hydrogen exchanger NHA2, Na(+)/H(+) exchanger-like domain-containing protein 2, Na+/H+ exchanger domain containing 2, NHA2NHE10, NHE domain-containing protein 2, Sodium/hydrogen exchanger-like domain-containing protein 2
Gene Symbols SLC9B2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to NHEDC2(Na+/H+ exchanger domain containing 2) The peptide sequence was selected from the C terminal of NHEDC2. Peptide sequence IFISFAWLPKATVQAAIGSVALDTARSHGEKQLEDYGMDVLTVAFLSILI.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 133308
Test Specificity Expected identity based on immunogen sequence: Rat: 100%; Mouse: 100%; Sumatran orangutan: 100%; Human: 100%; Bovine: 92%; Canine: 85%;.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.