Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NICE-3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP170653
Description
NICE-3 Polyclonal specifically detects NICE-3 in Human samples. It is validated for Western Blot.Specifications
NICE-3 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
C1ORF43 | |
Synthetic peptides corresponding to C1ORF43 The peptide sequence was selected from the middle region of C1orf43. Peptide sequence YQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQ. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%; Canine: 92%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
chromosome 1 open reading frame 43, HCV NS5A-transactivated protein 4 | |
Rabbit | |
Affinity purified | |
RUO | |
25912 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction