Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NICE-3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | NICE-3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
NICE-3 Polyclonal specifically detects NICE-3 in Human samples. It is validated for Western Blot.Specifications
NICE-3 | |
Polyclonal | |
Rabbit | |
chromosome 1 open reading frame 43, HCV NS5A-transactivated protein 4 | |
C1ORF43 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
25912 | |
Synthetic peptides corresponding to C1ORF43 The peptide sequence was selected from the middle region of C1orf43. Peptide sequence YQEALSELATAVKARIGSSQRHHQSAAKDLTQSPEVSPTTIQVTYLPSSQ. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title