Nicotinamide N-Methyltransferase/NNMT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155398

Catalog No. NBP155398

Description

Nicotinamide N-Methyltransferase/NNMT Polyclonal specifically detects Nicotinamide N-Methyltransferase/NNMT in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

• Antigen: Nicotinamide N-Methyltransferase/NNMT
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.1.1.1, nicotinamide N-methyltransferase
• Host Species: Rabbit
• Molecular Weight of Antigen: 29 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry
• Gene Accession No.: P40261
• Gene Symbols: NNMT
• Immunogen: Synthetic peptides corresponding to NNMT(nicotinamide N-methyltransferase) The peptide sequence was selected from the N terminal of NNMT. Peptide sequence MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4837
• Target Species: Human, Mouse, Rat, Pig, Canine
• Form: Purified

For Research Use Only