Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody, Novus Biologicals™

Nicotinic Acetylcholine R alpha 5/CHRNA5 Antibody, Novus Biologicals™
SDP

Catalog No. NBP1692220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1692220 20 μL
NBP169122 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1692220 Supplier Novus Biologicals Supplier No. NBP16912220UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit Polyclonal Antibody has been used in 2 publications

Nicotinic Acetylcholine R alpha 5/CHRNA5 Polyclonal specifically detects Nicotinic Acetylcholine R alpha 5/CHRNA5 in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen Nicotinic Acetylcholine R alpha 5/CHRNA5
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Alias Cholinergic receptor, neuronal nicotinic, alpha polypeptide-5, cholinergic receptor, nicotinic, alpha 5, cholinergic receptor, nicotinic, alpha polypeptide 5, LNCR2, NACHRA5, neuronal acetylcholine receptor subunit alpha-5, neuronal nicotinic acetylcholine receptor, alpha5 subunit
Gene Symbols CHRNA5
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CHRNA5 (cholinergic receptor, nicotinic, alpha 5) The peptide sequence was selected from the middle region of CHRNA5. Peptide sequence PDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD.
Molecular Weight of Antigen 53 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1138
Test Specificity This product is specific to Subunit or Isoform: alpha-5.
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.