Nidogen-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159148

Catalog No. NBP159148

Description

Nidogen-2 Polyclonal specifically detects Nidogen-2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Nidogen-2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: NID-2, nidogen 2 (osteonidogen), nidogen-2, osteonidogen
• Host Species: Rabbit
• Molecular Weight of Antigen: 148 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Guinea pig: 100%; Human: 100%; Pig: 100%; Equine: 92%; Mouse: 92%; Rat: 85%; Rabbit: 84%; Chicken: 83%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q14112
• Gene Symbols: NID2
• Immunogen: Synthetic peptides corresponding to NID2(nidogen 2 (osteonidogen)) The peptide sequence was selected from the middle region of NID2. Peptide sequence DDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGTTPACIPTVAPPMV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 22795
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.