Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Nidogen-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Nidogen-2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Nidogen-2 Polyclonal specifically detects Nidogen-2 in Human samples. It is validated for Western Blot.Specifications
Nidogen-2 | |
Polyclonal | |
Rabbit | |
Q14112 | |
22795 | |
Synthetic peptides corresponding to NID2(nidogen 2 (osteonidogen)) The peptide sequence was selected from the middle region of NID2. Peptide sequence DDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGTTPACIPTVAPPMV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
NID-2, nidogen 2 (osteonidogen), nidogen-2, osteonidogen | |
NID2 | |
IgG | |
148 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title