Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NIFK Antibody (CL2237), Novus Biologicals™
SDP

Catalog No. NBP236750 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP236750 0.1 mL
NB404708 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP236750 Supplier Novus Biologicals Supplier No. NBP236750
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

NIFK Monoclonal specifically detects NIFK in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen NIFK
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL2237
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9BYG3
Gene Alias hNIFK, MKI67 (FHA domain) interacting nucleolar phosphoprotein, MKI67 FHA domain-interacting nucleolar phosphoprotein, NIFKNOPP34, Nopp34, Nucleolar phosphoprotein Nopp34, Nucleolar protein interacting with the FHA domain of pKI-67
Gene Symbols MKI67IP
Host Species Mouse
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEI
Purification Method Protein A purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 84365
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reconstitution Protein A purified
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.