Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NIP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17988320UL
Description
NIP Polyclonal specifically detects NIP in Human samples. It is validated for Western Blot.Specifications
NIP | |
Polyclonal | |
Western Blot 1:1000 | |
NP_653166 | |
DUOXA1 | |
The specific Immunogen is proprietary information. Peptide sequence PEEGGLLSPRYRSMADSPKSQDIPLSEASSTKAYYRPRRLSLVPADVRGL. | |
Affinity Purified | |
RUO | |
90527 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Dual oxidase activator 1, dual oxidase maturation factor 1, dual oxidase maturation factor 1 delta, dual oxidase maturation factor 1 gamma, FLJ32334, homolog of Drosophila Numb-interacting protein, mol, NIPdual oxidase maturation factor 1 alpha, Numb-interacting protein, NUMBIPdual oxidase maturation factor 1 beta | |
Rabbit | |
53 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction