NIR2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Supplier:  Novus Biologicals NBP169043

Catalog No. NBP169043

Description

NIR2 Polyclonal specifically detects NIR2 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: NIR2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O35954
• Gene Symbols: PITPNM1
• Immunogen: Synthetic peptides corresponding to PITPNM1 (phosphatidylinositol transfer protein, membrane-associated 1) The peptide sequence was selected from the N terminal of PITPNM1. Peptide sequence PDGGQQPNVFNLSGAERRQRIVDTIDIVRDAVAPGEYKAEEDPRLYRSAK The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DRES9NIR-2, Drosophila retinal degeneration B homolog, FLJ44997, membrane-associated phosphatidylinositol transfer protein 1, NIR2PITPNM, phosphatidylinositol transfer protein, membrane-associated 1Pyk2 N-terminal domain-interacting receptor 2, PITPnm 1, Rd9, RDGB, RDGB1, RDGBA, RDGBA1, retinal degeneration B alpha 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 135 kDa
• Quantity: 100 mL
• Research Discipline: Vision
• Gene ID (Entrez): 9600
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG